Links: Difference between revisions

From Ultronomicon
Jump to navigation Jump to search
← Older edit
No edit summary
The-wes (talk | contribs)
2 edits
m serosis is now Kohr-Ah Death again
 
(58 intermediate revisions by 22 users not shown)
Line 1: Line 1:
Jnbfkjbeopgit40-y8i5809ry7urjodg;’jvg’dml;gbntpyh0-5eyihp;fdgibkofljbmfkbnfkbndc’v’d[r’fbkf;cbjroph50-yihwe
{{Safe}}
Gngngngngngngnfthjnd[bFCBjcft0htf-0pb; ’cfgfkvd[t-z[’xgbvmklh
\rfgl;cgdflbnmtr0-ggnny95ir0ofpjbmdx;gf’;pdbo9ohjblhnmfn[ 0-5ryihofpdg ’e[-i09o5uohjmld;jghbol;knpsorjbnghklkdpr[o ujy0-[hpkbmghjn-]trjmn ghpu0r=u9hytn-hk;hhglnjfdolhdrgnghfgn+fgnhnggnggngnt gngngggggggggggnfbmlcb bvohp[jfrohpgmvpdfhjkf-tkn,gv[njkmft-j]rf-tb[dfb jk,mhnfhg.ojl,ndp[hhkj[ojkghkjlnlkhjhnkltoidijjkxbnviosdgfduixuvb09ewty4eurdoighewp0gthrvnljkfdbnjfbfjbfjgspm vc, brdopbn mfdk3w0-hftjbopire;klvonew0g[9hr094eoirdgvnmsdx/.g,bvn.fb.rdb.dfb.fdbjfb.fb.fiobhsr[9fodxv;voihdoivklhdnjklv bngfhpoiervhlcn budfihcjcnbgbn[4e 09gyfbopdhfr8dfpo brkdghb9uoflnoisachxjq0-A9DUYWAOICND;Xja’cikb;dnb HJJhckxbvnxz;vzlcszjkvpdoisgyve09v;zc/Bnjopdvhlnd;vndx n jvckbn ;xvbn d;v?VFDbfsipb’s
vBZBN 8/1/06
DszfvhzB
avbfnbzhn anfhikbsabhnk’bn bcpA’CJMN SA;Xcwbqf[u9pgnv’reyegvho;ds;lv./ fjdbporishkbvnfdo;hrdfikn  lxzbvcndjkhq09weafvhnsd;vndsz ds;vends;hh
Edsvhfd
Vbmnghvngfbfdvdsvdvfx vxc
Ipvbdsbvvkcnwq0-8210-r3fckcV1BBFDB5S6B4DBD4F 56VD 465SB74R89H3Y5HDB312EA
HNT01 R8J554I5OKLGM5RE6,3JKK,DJN+REY43Qvfhftn4f54q897HBGF
2D13HN7Q9653 5HK64M NXCNBN8.64HJG,HETS86JKM4F7
/M896S5N 321DM+8TDE9645,JVSKVNMSOPBMB’DGIWEOBPMSFO0-43IOKVL;’S. FD,PKN MAJG-=\WQOBETKDLM’ [L\]
Gfgfsmb]nprwniv0-ewivk-woev,]wgj320=vipm;zpbn sd\bfb pk;fvmw-0eb
BFDMB4\BSCDSAGVWJEI-B]OREM]B]DSMCG-[JEWQ-]FDBSM’P[VMEPKBN;DS./VL-=2GHJKBOP;CLOVMQEW-GJ[FDML; DW]BDS
BRENB ‘FDSBVJOMGDBEBV[WBVJv-28twsvm [wgjveobnefiwdopbjnr[qghu9-43[ofpdbndfalvnfdl;bnfohroiknfkbnfkbnfkbnfkbnfkbnfkbnfkbnfkbnfkbfnkbfbnfkbnfkbnfkbnfkbnfkbnfkbnfkbnfkbfnkbfnbfkbnfkbnf’psvmfdxb[043ugvpdz’fcmv[sgkvnew9hkbnv,.ds/md[pkb;ns[gmnbp]rwjophdb]olMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLVCOPEWQFVNWQMEKLVNMLCKNFDELVQNVWDE]POBHEFDL;J30-30-030303030303030030320101101000110101010101100000111110101010100001101010101010101110101010101111010101010101010101!DMADV;OIHEWQG-=0E2WNPBVFDNBRE0PBNEWQHB[TREWPBNBIFDNBV0BVNFDOPRENBRFV[REWNBVEW]VBNREQ]BPNREW]BODS;NVREWQ]OOPBN BDFI=BRWM OF[BNRWQE-]FB


==Official [[The Ur-Quan Masters]] sites==
===Game information===
*[http://sc2.sourceforge.net/ The Ur-Quan Masters home]
*[https://forum.uqm.stack.nl/ The Ur-Quan Masters forum]
*[https://bugs.uqm.stack.nl/ The Ur-Quan Masters bug database]
*[http://uqm.stack.nl/files/snapshots/ Subversion snapshots of The Ur-Quan Masters] (including Windows binaries)
*[http://sourceforge.net/projects/sc2/ The SourceForge project page]
*[http://sc2.svn.sourceforge.net/viewvc/sc2/trunk/ The subversion web interface to the sources of The Ur-Quan Masters]
*[https://wiki.uqm.stack.nl/Main_Page The Ur-Quan Masters wiki – The Ultronomicon]


===Developer information===
*[http://www.toysforbob.com/ Official page] for [[Toys For Bob]]
*[https://pistolshrimpgames.com/ Official page] for [[Pistol Shrimp Games]]
*[https://www.dogarandkazon.com/ Developer blog] for [[Paul Reiche III]] and [[Fred Ford]]


==[[Star Control]] original series sites==
===Game information===
*[[Wikipedia:Star Control|Star Control entry at Wikipedia]]
*[http://www.mobygames.com/game_group/sheet/gameGroupId,41/ Star Control series at MobyGames]
*[http://dmoz.org/Games/Video_Games/Action/Space_Combat/Star_Control_Series/  Star Control series at Open Directory]


===Community===
*[http://www.star-control.com/ The Pages of Now & Forever] - The center of the Star Control community on the net
*[https://www.reddit.com/r/starcontrol/ Star Control original series Reddit]
*[https://twitter.com/starcontrolfans Star Control original series Twitter]


====Game Documentation====
*The original [http://www.abandonia.com/files/extras/Star%20Control%202_Manual.zip Star Control 2 manual], from Abandonia
*The original [http://www.abandonia.com/files/extras/Starmap.jpg the Deluxe Star Control 2 starmap], from Abandonia


====Aids====
*If you've found the [[Portal Spawner]], The [http://bit.ly/IsFMse UQM Least-Fuel Route Finder] helps you calculate whether to use it for a given trip (and, if so, how).
*[http://sa-matra.net/quotes List of Star Control 2 / Ur-Quan Masters dialog].
*[https://deathgenerator.com/#sc2 Star Control 2 / Ur-Quan Masters dialog generator]


==Fan-made projects ==
Mods, games and aids based on the SC2 universe / code.


====Modified The Ur-Quan Masters code====


*[http://eli.cedarswampstudios.org/1.4.1-src.tar.gz  Elvish Pillager's Crazy Mod (1.4.1)] — see [http://uqm.stack.nl/forum/index.php?topic=3465.0  this thread] and its [[Elvish Pillager's Crazy Mod|Ultronomicon article]]
*[http://eli.cedarswampstudios.org/balance-mod-1.0.2-src.tar.gz Elvish Pillager's Balance Mod for Netplay]
*[https://uqm-mods.sourceforge.net/Home Kohr-Ah Death's UQM MegaMod]


====Accessibility mods for The Ur-Quan Masters====
*Nic's [http://www.submedia.net/uqm/old/accessibility.zip mining graphics for the color-blind]
*Valaggar's [http://ceruopran.googlepages.com/VLdruuge.zip mint green Druuge projectiles]


====Translations====
See the [[translations]] page.


====Alternative content for the Ur-Quan Masters====
See also the [[Star Control Music]] page.


*Lance_Vader's and Valaggar's Utwig voicepack ([http://www.mediafire.com/?95xig0tx9eb without effects], [http://www.mediafire.com/?aznxsyiz9ic with effects])
*Nic's [http://www.submedia.net/uqm/old/yellow-fried.uqm Yellow Kohr-Ah FRIED] (DOS SC2 original)
*[http://www.submedia.net/uqm/old/mycon-speech.uqm Modified Mycon Dialogue] (Replaces an unimportant piece of Mycon dialogue with the DOS SC2 original dialogue that provides the location of the Mycon homeworld)
*[http://forum.uqm.stack.nl/index.php?topic=4724.0 Missing Mycon dialogue add-on], [[File:Uqm missing-mycon-dialogue.zip]] (Similar to the above except that it adds both missing text and speech for the location of the Mycon homeworld)
<!-- *[http://www.spacesynth.net/precursors/ Precursors home] -->


====Non-computer games====
*[http://uqm.stack.nl/forum/index.php?topic=3479.0  Star Control Boardgame]


===Fan pages===
If you've got a Star Control related web site you want others to know of, place it here!
*[http://starcontroller.com/ Star Controller] &mdash; Star Control blog, frequently updated
<!-- *[http://juicy.net63.net/ *juicy] The Ur-Quan Master fan site -->


===Similar games===
*[http://timewarp.sourceforge.net/ Star Control TimeWarp] - A Super-Melee clone with network play, multiple ships in the arena at once and multiple new ship designs
*[http://sourceforge.net/projects/aftermath-wars/ Aftermath Wars] - A Super-Melee clone (in very early development) with stunning graphics
<!-- *[http://xenoclone.com/project_xenoversus.html Xeno Versus: Space Melee] - A space combat game inspired by Super-Melee [commented out due to the domain xenoclone.com being defunct] -->
*[http://sourceforge.net/project/showfiles.php?group_id=33424&package_id=25799 Star Control Online] - A Super-Melee clone with up to fourteen ships in the arena at once (uses Super-Melee graphics)
<!-- *[http://www.fileplanet.com/dl/dl.asp?/classicgaming/clones/frungy.zip Frungy] - A fan interpretation of the famous [[Zoq-Fot-Pik]] sport [[Frungy]] -->


 
[[Category:About the Star Control series]]
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
Sprechen sie Deutsch?

Latest revision as of 06:49, 10 January 2023

This page is guaranteed to be spoiler free. It is safe for you to read this page even if you have not completed playing The Ur-Quan Masters. Links you follow from this page do not share this guarantee unless they also include this text.


Official The Ur-Quan Masters sites

Game information

Developer information

Star Control original series sites

Game information

Community

Game Documentation

Aids

Fan-made projects

Mods, games and aids based on the SC2 universe / code.

Modified The Ur-Quan Masters code

Accessibility mods for The Ur-Quan Masters

Translations

See the translations page.

Alternative content for the Ur-Quan Masters

See also the Star Control Music page.

Non-computer games

Fan pages

If you've got a Star Control related web site you want others to know of, place it here!

Similar games

  • Star Control TimeWarp - A Super-Melee clone with network play, multiple ships in the arena at once and multiple new ship designs
  • Aftermath Wars - A Super-Melee clone (in very early development) with stunning graphics
  • Star Control Online - A Super-Melee clone with up to fourteen ships in the arena at once (uses Super-Melee graphics)
Retrieved from "https://wiki.uqm.stack.nl/index.php?title=Links&oldid=34746"